Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318605.1	internal	130	391-2(-)
Amino Acid sequence :
GNQTEKQANPNLTLRGFSFIDAVKRLVEAECPGVVSCADIIALVARDAVVTTGGPFWNVPTGRRDGTISNVSEANADIPAPTSNFTRLQQSFAKKGLDLKDLVLLSGAHTTGVSHCSSFT ERLYNFTGVL
Physicochemical properties
Number of amino acids:		130
Molecular weight:		13,852.464
Theoretical pI:		6.914
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		35.346
aromaticity		0.069
GRAVY		-0.052
Secondary Structure Fraction
Helix		0.292
turn		0.269
sheet		0.223