Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318612.1 | internal | 140 | 422-3(-) |
Amino Acid sequence : | |||
GNNNIVNSGGNQPFVTAGQLPAGLSLQQLMFGSITVVDNDITEGHELGTSILGRAQGFYLTSSSDGTSHTLALTTLFHGHEHEVDDTISFFGIHRTATPISHIAIIGGTGKYENAKGYAT IETMPHVDQHTTDGVETITH | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 14,829.121 | ||
Theoretical pI: | 5.219 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 28.852 | ||
aromaticity | 0.064 | ||
GRAVY | -0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.279 | ||
sheet | 0.193 |