Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318620.1	internal	107	323-3(-)
Amino Acid sequence :
RHAGEDGEPQPKVVRRGRPPGKNLKKSVENSPIDRVVPELSSCATLASGDDKAIGSDSYNLRKGPMLSKFHSPDASFAHRSRNGESYNELLTDWNNEFPANILRADM
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,803.965
Theoretical pI:		8.101
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		57.283
aromaticity		0.056
GRAVY		-0.930
Secondary Structure Fraction
Helix		0.206
turn		0.346
sheet		0.234