Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318620.1 | internal | 107 | 323-3(-) |
Amino Acid sequence : | |||
RHAGEDGEPQPKVVRRGRPPGKNLKKSVENSPIDRVVPELSSCATLASGDDKAIGSDSYNLRKGPMLSKFHSPDASFAHRSRNGESYNELLTDWNNEFPANILRADM | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,803.965 | ||
Theoretical pI: | 8.101 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 57.283 | ||
aromaticity | 0.056 | ||
GRAVY | -0.930 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.346 | ||
sheet | 0.234 |