Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318625.1	3prime_partial	162	486-1(-)
Amino Acid sequence :
MEFFRSAVLLVFLLSCFSFSSTDAFDALDPNGNITIKWDVINWTPDGYVATVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPY NQQVANCCKGGVINSWGQDPQSAVSSFQVSVGSAGTTNKTVR
Physicochemical properties
Number of amino acids:		162
Molecular weight:		17,943.164
Theoretical pI:		6.691
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		42970 43345
Instability index:		23.633
aromaticity		0.123
GRAVY		-0.156
Secondary Structure Fraction
Helix		0.302
turn		0.265
sheet		0.154