Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318631.1 | internal | 130 | 392-3(-) |
Amino Acid sequence : | |||
VGPVSYLLLSKPAKGVEKSFPLLSLLDKILPVYKEVISELKAAGASWIQFDEPTLVLDLEAHQLEAFTKAYAELESTLSGVDVLVESYFADVPAGAFKILTALKGVTAFGFDLVRGTQTL DLIKTSFPTG | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,991.040 | ||
Theoretical pI: | 4.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 18.650 | ||
aromaticity | 0.100 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.200 | ||
sheet | 0.331 |