Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318633.1 | internal | 139 | 418-2(-) |
Amino Acid sequence : | |||
AEEVKNPQRDLPMGIGFALSICCSLYMLVSAVIVGLVPYFAMDPDTPISSAFARHGINWAAYLITIGACTSLCSTLMGSILPQPRILMAMARDGLLPSFFSDVNKHTQVPVKGTIATGLL SGTLAFFMNVEQLSGMVSV | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,800.334 | ||
Theoretical pI: | 6.058 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 32.176 | ||
aromaticity | 0.079 | ||
GRAVY | 0.637 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.266 | ||
sheet | 0.288 |