Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318639.1	internal	107	322-2(-)
Amino Acid sequence :
ELSQIQMMLTNYYPPCPDPSSALGSGGHYDGNLITLLQQDLPGLQQLIVKDATWIAVQPIPTAFVVNLGLTLKVITNEKFEGSIHRVVTDPTRDRVSIATLIGPDYS
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,678.250
Theoretical pI:		4.778
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		33.125
aromaticity		0.065
GRAVY		0.035
Secondary Structure Fraction
Helix		0.346
turn		0.262
sheet		0.215