Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318640.1	internal	134	1-402(+)
Amino Acid sequence :
ASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPSFSSRLYNFTGVWGKQDPSLDGEYAANLKMKKCKSINDNTTIVEMDPGSASKFDLGYYKLVLKRRGLFQSDAA LTTSATTKSYINHL
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,481.234
Theoretical pI:		8.896
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		35.209
aromaticity		0.090
GRAVY		-0.237
Secondary Structure Fraction
Helix		0.284
turn		0.299
sheet		0.239