Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318645.1	internal	170	511-2(-)
Amino Acid sequence :
RTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAAEEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQ RQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGG
Physicochemical properties
Number of amino acids:		170
Molecular weight:		18,404.968
Theoretical pI:		8.790
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		31.822
aromaticity		0.076
GRAVY		-0.066
Secondary Structure Fraction
Helix		0.300
turn		0.235
sheet		0.253