Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318653.1	internal	180	540-1(-)
Amino Acid sequence :
SRARAQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAESQAVEVSRRQAKLREGTGHPDMAYKLEAAEAKLHDLKSNMNTLGKEASAAMAAVEAQQQRLTLQRLI AMVESERSYHQRILQILDQLEAEMLSERQRIEAAPAPAPSMDTMPPPPSYEEINDVSTSP
Physicochemical properties
Number of amino acids:		180
Molecular weight:		20,130.666
Theoretical pI:		5.873
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		55.878
aromaticity		0.022
GRAVY		-0.685
Secondary Structure Fraction
Helix		0.189
turn		0.183
sheet		0.422