Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318656.1 | internal | 176 | 529-2(-) |
Amino Acid sequence : | |||
THPTKEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMVINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALV CINGMILKVIGNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,256.978 | ||
Theoretical pI: | 6.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 40.849 | ||
aromaticity | 0.045 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.267 | ||
sheet | 0.256 |