Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318660.1 | 3prime_partial | 191 | 60-632(+) |
Amino Acid sequence : | |||
MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSNEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESAAYGKVLTLDGAIQHTENGGFPYTEMIVHLPL GSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAF | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 20,881.497 | ||
Theoretical pI: | 5.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 24.409 | ||
aromaticity | 0.099 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.288 | ||
sheet | 0.209 |