Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318676.1 | internal | 104 | 314-3(-) |
Amino Acid sequence : | |||
TDARKDPGEYWRAVMKDELMPEVIQHLMPRRHSVPLSKEKTDFHKSTFEPRPNLSVYPDDTKLKGAEKSLFSKDFEPRPNASSYHDDEAGLKQEKDFEPRPNVS | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,099.372 | ||
Theoretical pI: | 6.062 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 38.388 | ||
aromaticity | 0.087 | ||
GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.250 | ||
sheet | 0.240 |