Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318684.1 | internal | 199 | 598-2(-) |
Amino Acid sequence : | |||
ENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEI DDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 21,760.671 | ||
Theoretical pI: | 4.717 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 33.852 | ||
aromaticity | 0.121 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.241 | ||
sheet | 0.231 |