Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318684.1	internal	199	598-2(-)
Amino Acid sequence :
ENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEI DDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV
Physicochemical properties
Number of amino acids:		199
Molecular weight:		21,760.671
Theoretical pI:		4.717
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 22920
Instability index:		33.852
aromaticity		0.121
GRAVY		0.131
Secondary Structure Fraction
Helix		0.372
turn		0.241
sheet		0.231