Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318685.1	internal	155	467-3(-)
Amino Acid sequence :
AFQLARKGLNLVLVGRNPDKLNDVSESIKGKYGKTQIKTVVVDFSGDLDEGVKKVKEIIDGLDVGVLINNVGVSYPYTRFFHEVDDKLLADLIKVNVEGTTKVTQAVLPGMVQRKGGAIV NIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYV
Physicochemical properties
Number of amino acids:		155
Molecular weight:		16,759.191
Theoretical pI:		8.601
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		10430 10430
Instability index:		6.522
aromaticity		0.077
GRAVY		0.115
Secondary Structure Fraction
Helix		0.381
turn		0.219
sheet		0.200