Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318694.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
SDLSKKKNNPSNYHSKPLRSKFIDLDDEFEAIFQDFKDYSDDDDVKSFGSKSVKSVDSNCEADKSSKRKRKNQFRGIRQRPWGKWAAEIRNPRKGIRVWLGTFNSAEEAARAYDVEARRI RGKKAKVNFPDDVPVSASRRVIKLNPQEALCKESSNIVQSNVMDSESLGYFEEKH* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,136.240 | ||
Theoretical pI: | 9.449 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 41.515 | ||
aromaticity | 0.091 | ||
GRAVY | -1.067 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.263 | ||
sheet | 0.183 |