Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318698.1 | internal | 115 | 346-2(-) |
Amino Acid sequence : | |||
AFPFIDAVKRLVEAECPGVVSCADIIALVARDAVVTTGGPFWNVPTGRRDGTISNVSEANADIPAPTSNFTRLQQSFAKKGLDLKDLVLLSGAHTIGVSHCSSFTERLYNFTGVL | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,222.777 | ||
Theoretical pI: | 6.087 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.717 | ||
aromaticity | 0.078 | ||
GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.252 | ||
sheet | 0.226 |