Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318702.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
KGDSATEPYIVAHNLLLAHATAVKVYKQKYQKTQKGQIGVTLVTHWFVPKIKTPLGLKAPLKALDFFLGWFLDPITYGDYPASMRANVGRRLPKFTAEQKKLVKGSIDFLGMNYYTTQYA SPMLSVPRVNLSYTTDNHVDMTAQKDGIPI | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,820.372 | ||
Theoretical pI: | 9.698 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
Instability index: | 18.199 | ||
aromaticity | 0.113 | ||
GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.207 | ||
sheet | 0.220 |