Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318707.1 | internal | 155 | 467-3(-) |
Amino Acid sequence : | |||
ARAGIKGDNMGLKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTT WTLLYEKKTEDTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,455.756 | ||
Theoretical pI: | 6.200 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 16.184 | ||
aromaticity | 0.077 | ||
GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.181 | ||
sheet | 0.200 |