Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318718.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
ARTWGTTAPGLPYAEEAITNAGNWLIGGDLEVIEPIKYHDGLDRFRLSPAELRDEFTRRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPVLLLHPLGGYTKADDVPLQWRMKQ HEMVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPLEKRDLYDAE | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 21,298.897 | ||
Theoretical pI: | 5.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32430 | ||
Instability index: | 53.313 | ||
aromaticity | 0.090 | ||
GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.217 | ||
sheet | 0.302 |