Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318721.1	internal	141	423-1(-)
Amino Acid sequence :
IHQLCKMRNLYLFFVLICMVSYVVGQGGLKPGFYSSSCPNAESIVKSTVQAEFNEDPTIAPGLLRLHFHDCFVQGCDGSVLIFGTSAERNAVTNTGLRGFEVIDNAKIKLEASCPGVVSC ADILALAARDAVDLSGGPSWG
Physicochemical properties
Number of amino acids:		141
Molecular weight:		15,029.125
Theoretical pI:		5.494
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10345
Instability index:		32.467
aromaticity		0.085
GRAVY		0.311
Secondary Structure Fraction
Helix		0.333
turn		0.270
sheet		0.241