Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318727.1 | internal | 118 | 354-1(-) |
Amino Acid sequence : | |||
GRAYNTGASVSLVSAEETEIFEEVKSLLGENEDKVSQFIAPFPLLSKNAVDSLRYRAEDVARSVTKIAVRESRAQDLRNEILNSQKLKAHFQDNPKDLDLLKHDKMLSKKAPAPHLRD | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,259.822 | ||
Theoretical pI: | 7.046 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 44.257 | ||
aromaticity | 0.051 | ||
GRAVY | -0.620 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.212 | ||
sheet | 0.314 |