Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318730.1 | internal | 130 | 391-2(-) |
Amino Acid sequence : | |||
GNQTEKQANPNLTLRGFSFIDAVKRLVEAEYPGVVSCADIIALVARDAVVTTGGPFWNVPTGRRDGTISNVSEANADISAPTSNFTRLQQSFAKKGLDLKDLVLLSGAHTIGVSHCSSFT ERLYNFTGVL | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,447.152 | ||
Theoretical pI: | 8.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 35.153 | ||
aromaticity | 0.083 | ||
GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.278 | ||
sheet | 0.278 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318730.1 | complete | 108 | 60-386(+) |
Amino Acid sequence : | |||
MVWAPDNRTKSFRSRPFFAKDCCSLVKLLVGAEMSALASETFDIVPSLLPVGTFQNGPPVVTTASLATKAIISAQETTPGYSASTSLFTASMNEKPLNVKLGLACFSV* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,447.152 | ||
Theoretical pI: | 8.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 35.153 | ||
aromaticity | 0.083 | ||
GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.278 | ||
sheet | 0.278 |