Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318743.1 | internal | 137 | 413-3(-) |
Amino Acid sequence : | |||
LDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVVSGLARRCIVQVSYTIGVAEPLSVFVDTYKTGTIPDKDILVLIKESFDF RPGMMSINLDLLRGGNF | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,738.948 | ||
Theoretical pI: | 9.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 49.309 | ||
aromaticity | 0.080 | ||
GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.179 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318743.1 | 5prime_partial | 112 | 412-74(-) |
Amino Acid sequence : | |||
LMRTPSFTSTHQVASSLVAHMEMPVSLAGKSSSIPMEAGELMVVVLSQERTQLRWTGAVLTLLGRQQRVWLSQDLLAAVLCRFLILLVWLNHFLCLLTLTRQEQSPTRIFWF* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,738.948 | ||
Theoretical pI: | 9.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 49.309 | ||
aromaticity | 0.080 | ||
GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.179 | ||
sheet | 0.339 |