Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318753.1	internal	172	517-2(-)
Amino Acid sequence :
KEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPRCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVCING MILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE
Physicochemical properties
Number of amino acids:		172
Molecular weight:		18,850.502
Theoretical pI:		6.177
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17335
Instability index:		42.506
aromaticity		0.047
GRAVY		-0.162
Secondary Structure Fraction
Helix		0.297
turn		0.267
sheet		0.267