Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318756.1 | internal | 120 | 360-1(-) |
Amino Acid sequence : | |||
YVVGQGGLKPGFYSSSCPNAESIVKSTVQAEFNEDPTIAPGLLRLHFHDCFVQGCDGSVLIFGTSAERNAVTNTGLRGFEVIDNAKIKLEASCPGVVSCADILALAARDAVDLSGGPSWG | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,474.913 | ||
Theoretical pI: | 4.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 29.537 | ||
aromaticity | 0.075 | ||
GRAVY | 0.147 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.300 | ||
sheet | 0.233 |