Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318761.1 | internal | 149 | 448-2(-) |
Amino Acid sequence : | |||
DVFDRNHDSLISVDELIQALDLLGLDADQSDIESMVKSYIKPENTGLKFEDFEALHRSLNDVFFGSKYEDKIGLDRDQSDPEQDESDLKEAFDVFDENGDGFISAKELQVVLEKLGLPEG SEIDRVEMMISSVDQDLDGRVNFFEFKHM | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,986.475 | ||
Theoretical pI: | 4.104 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 32.140 | ||
aromaticity | 0.087 | ||
GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.201 | ||
sheet | 0.275 |