Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318762.1 | 5prime_partial | 146 | 475-35(-) |
Amino Acid sequence : | |||
SRIRNAARMLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPFGGGRP GRVKRKNQKAAAKKASGGDGDEEDEE* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,740.034 | ||
Theoretical pI: | 10.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 57.142 | ||
aromaticity | 0.055 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.199 | ||
sheet | 0.274 |