Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318769.1	internal	123	370-2(-)
Amino Acid sequence :
FFTNKVVQQYRGGWESEVASVVEDVKKNPESATNGIVLRKRLQLMMYNNMFRIMFDKRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKEKRLKLFKDY FVD
Physicochemical properties
Number of amino acids:		123
Molecular weight:		14,720.928
Theoretical pI:		9.458
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14440
Instability index:		37.812
aromaticity		0.146
GRAVY		-0.481
Secondary Structure Fraction
Helix		0.366
turn		0.187
sheet		0.244