Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318771.1 | internal | 129 | 388-2(-) |
Amino Acid sequence : | |||
VKDRTIGVAMDFSKSSRTALKWAIGNLADKDDTFYIIHIKSHSSDESRNKLWAQSGSPLIPLMEFRETEVLQKYDVEPDIEVLDLLDTATRQKEIKVVIKLYWGDAREKLCDAIEDLKLN SLIMGSRGL | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,697.686 | ||
Theoretical pI: | 5.413 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 40.619 | ||
aromaticity | 0.070 | ||
GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.178 | ||
sheet | 0.271 |