Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318779.1	internal	131	395-3(-)
Amino Acid sequence :
QEYKFKALKKATNNFDEKNKLGQGGYGVVYRGFLAAEDKDIAVKWFSRESIKGEDDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDMHLFAGPDKQPLSWLVRYKIVQ GVASALHYLHN
Physicochemical properties
Number of amino acids:		131
Molecular weight:		15,106.307
Theoretical pI:		9.385
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		30.843
aromaticity		0.122
GRAVY		-0.384
Secondary Structure Fraction
Helix		0.359
turn		0.198
sheet		0.275