Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318782.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
LSKYLTSASLRKTMASLVSSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEP NLDQKPKLFIEKEYKPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,417.796 | ||
Theoretical pI: | 5.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 44.279 | ||
aromaticity | 0.099 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.217 | ||
sheet | 0.263 |