Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318787.1	internal	165	495-1(-)
Amino Acid sequence :
RYDPFIAKLFVEEYDHKGMKDERRRAIEKARGSKNWGIVLGTLGRQGNPRILDRLEKKMSEKGMTWTVVLMSEISPTRIALFEDAVDAWIQIACPRLSIDWGDAFKRPLLTPFEAEIALG DLSGWWERKKTAVNSGEFCDEGLKGSKNESCSACDNNGGEKVHEG
Physicochemical properties
Number of amino acids:		165
Molecular weight:		18,619.983
Theoretical pI:		6.227
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35980 36230
Instability index:		47.716
aromaticity		0.085
GRAVY		-0.569
Secondary Structure Fraction
Helix		0.267
turn		0.230
sheet		0.273