Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318797.1 | 3prime_partial | 111 | 335-3(-) |
Amino Acid sequence : | |||
MGSLAEKWEELSGKNNWNGLLDPLDVDLRRYIIQYGELAHVTYDTFIDDKASKYAGASRYSMENLFARAGLDPSKYKVTKYFYATSSMPLPVAFILQSASREAWSKESNFM | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,678.168 | ||
Theoretical pI: | 5.781 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 40.851 | ||
aromaticity | 0.144 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.243 | ||
sheet | 0.297 |