Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318801.1	internal	169	3-509(+)
Amino Acid sequence :
KIQRGCSLGHLWTFFSLKFAVGFLTSIFLRMETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAVVDYEKIVRNTCRNIGFVSDDVGLDADNC KVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELCL
Physicochemical properties
Number of amino acids:		169
Molecular weight:		11,509.342
Theoretical pI:		7.743
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		21.810
aromaticity		0.038
GRAVY		0.361
Secondary Structure Fraction
Helix		0.381
turn		0.219
sheet		0.267

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318801.1	complete	105	422-105(-)
Amino Acid sequence :
MAMDTLSNIRTLLLNVNKDLAVVGIKTNIIRNESNITACVTNNLLIVYNSLGCDLTKDHDQVSLGASFTGNLAFRILLKAGIKNCIRDLITELVWVTLVHRLGGE*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,509.342
Theoretical pI:		7.743
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		21.810
aromaticity		0.038
GRAVY		0.361
Secondary Structure Fraction
Helix		0.381
turn		0.219
sheet		0.267