Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318802.1 | internal | 178 | 536-3(-) |
Amino Acid sequence : | |||
STFHFYSTKRASSDESLLKVIQAEIACAEESDELGEVEEVPEGFPFKIEDNPGQQTVKLTRAYQGETIDVEVHMPDLVTGDEDENDNDADDSERANQSQIPLVVRVSKKNGPSLEFGLTA FADEIAIETLAIKDANVAEDQIAYEGPDFSDLDENLQKAFHKYLEIRGIKPSTTNFLH | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,794.410 | ||
Theoretical pI: | 4.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 40.362 | ||
aromaticity | 0.073 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.208 | ||
sheet | 0.287 |