Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318805.1	internal	106	320-3(-)
Amino Acid sequence :
DKISLNIHDDVFLALEKLFDLPTQTKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGNSAFSQALVSYSKAAAELEEMVVRMVFESYGVE
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,916.376
Theoretical pI:		4.594
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 12950
Instability index:		14.630
aromaticity		0.123
GRAVY		-0.108
Secondary Structure Fraction
Helix		0.349
turn		0.264
sheet		0.274