Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318816.1 | internal | 148 | 445-2(-) |
Amino Acid sequence : | |||
KEARMAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKGSNPNKNSARGFEVLDDIKSALEKECPQTVSCADILALAARDSTVLAGGPSWEVPLGRRDPRSASLSGSNNNIPAPNNTFNS ILSKFQRQGLDLVDLVALSGSHTIGNSR | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 15,776.594 | ||
Theoretical pI: | 7.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 41.507 | ||
aromaticity | 0.041 | ||
GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.318 | ||
sheet | 0.264 |