Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318820.1	internal	187	562-2(-)
Amino Acid sequence :
PGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYF PYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV
Physicochemical properties
Number of amino acids:		187
Molecular weight:		20,431.149
Theoretical pI:		4.654
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 22920
Instability index:		32.138
aromaticity		0.128
GRAVY		0.170
Secondary Structure Fraction
Helix		0.380
turn		0.241
sheet		0.225