Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318831.1 | internal | 167 | 501-1(-) |
Amino Acid sequence : | |||
GGLLGSMLIFLFSAWACAAVGRTAQEVVNEVRRQFIERPGIMEYKEKPDYGRCVSIVASASLREMIKPGALAIISPTAVGFLFRILGYYTGHPLLGAKVVASMLMFATVSGILMALFLNT AGGAWDNAKKYIETGALGGKGSDTHKAAITGDTVGDPFKDTAGPSLH | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 17,626.338 | ||
Theoretical pI: | 8.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 20.628 | ||
aromaticity | 0.090 | ||
GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.246 | ||
sheet | 0.299 |