Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318831.1	internal	167	501-1(-)
Amino Acid sequence :
GGLLGSMLIFLFSAWACAAVGRTAQEVVNEVRRQFIERPGIMEYKEKPDYGRCVSIVASASLREMIKPGALAIISPTAVGFLFRILGYYTGHPLLGAKVVASMLMFATVSGILMALFLNT AGGAWDNAKKYIETGALGGKGSDTHKAAITGDTVGDPFKDTAGPSLH
Physicochemical properties
Number of amino acids:		167
Molecular weight:		17,626.338
Theoretical pI:		8.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		20.628
aromaticity		0.090
GRAVY		0.305
Secondary Structure Fraction
Helix		0.317
turn		0.246
sheet		0.299