Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318835.1	internal	150	452-3(-)
Amino Acid sequence :
LVHYPVIFGDYPEIMKKNADTRIPLFTRHESKLVKGSVDFIGINHYFPARVKDKSDSLFSGCRDFNADMGAQVMYDIGHKLPTPYEVRPWDLYAVMEQLKQRYDNPPLFVHENGQRLPRN QTLIDTARINYARAYIGSVLRALRNGSDIR
Physicochemical properties
Number of amino acids:		150
Molecular weight:		17,372.655
Theoretical pI:		9.212
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18910 18910
Instability index:		34.683
aromaticity		0.113
GRAVY		-0.490
Secondary Structure Fraction
Helix		0.327
turn		0.227
sheet		0.200