Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318838.1	internal	120	3-362(+)
Amino Acid sequence :
LGRRDSKTANFKKANVNIPAPNSTIQNLISLFHKQGLNEEDLVALSGGHTIGMARCVSFRQRLYNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGK
Physicochemical properties
Number of amino acids:		120
Molecular weight:		13,215.772
Theoretical pI:		9.232
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11585
Instability index:		45.202
aromaticity		0.083
GRAVY		-0.447
Secondary Structure Fraction
Helix		0.292
turn		0.325
sheet		0.208