Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318838.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
LGRRDSKTANFKKANVNIPAPNSTIQNLISLFHKQGLNEEDLVALSGGHTIGMARCVSFRQRLYNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGK | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,215.772 | ||
Theoretical pI: | 9.232 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 45.202 | ||
aromaticity | 0.083 | ||
GRAVY | -0.447 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.325 | ||
sheet | 0.208 |