Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318842.1 | internal | 134 | 402-1(-) |
Amino Acid sequence : | |||
PGPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSKFNQTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFVFASPKVGDLNFQKAFSKL KHLHILRIHNLLDI | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,767.610 | ||
Theoretical pI: | 7.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 41.511 | ||
aromaticity | 0.097 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.261 | ||
sheet | 0.239 |