Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318849.1	5prime_partial	127	2-385(+)
Amino Acid sequence :
SFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMSNISPLTGSSGEIRKN CGKINSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,112.733
Theoretical pI:		9.614
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		45.874
aromaticity		0.102
GRAVY		-0.525
Secondary Structure Fraction
Helix		0.276
turn		0.323
sheet		0.213