Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318870.1 | internal | 131 | 394-2(-) |
Amino Acid sequence : | |||
RGIRQRPWGKWAAEIRDPRKGIRVWLGTFNSAEEAARAYDVEARRIRGKKAKVNFPDDAPVSASRRVVKLNPQEALCKESSSTVQSNVMDSGSDESLGYFEEKPLVKRYGYEDVCFYAGD MGLGSFSPSAA | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,593.220 | ||
Theoretical pI: | 9.171 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 49.086 | ||
aromaticity | 0.099 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.267 | ||
sheet | 0.244 |