Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318872.1 | internal | 118 | 355-2(-) |
Amino Acid sequence : | |||
VIGYKHQADTQAGGDVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAVCGVGFVKAFQSAYYNRYGGGVNVMAAGHTKGVGLAAEII | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,324.076 | ||
Theoretical pI: | 7.667 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 93960 94585 | ||
Instability index: | 65.506 | ||
aromaticity | 0.263 | ||
GRAVY | 0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.434 | ||
turn | 0.212 | ||
sheet | 0.141 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318872.1 | 5prime_partial | 99 | 353-54(-) |
Amino Acid sequence : | |||
NWLQASSRYSSRWRCLWWRWFTWYCLGLWWHDFCSCLLHRWYFWWTHQPCSDVWAIFSKEGIINQGSVVYGSTMFGCSLWCGICESFPECILQQIWWWC* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 12,324.076 | ||
Theoretical pI: | 7.667 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 93960 94585 | ||
Instability index: | 65.506 | ||
aromaticity | 0.263 | ||
GRAVY | 0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.434 | ||
turn | 0.212 | ||
sheet | 0.141 |