Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318881.1 | 3prime_partial | 153 | 460-2(-) |
Amino Acid sequence : | |||
MLFEPATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAI IVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,537.838 | ||
Theoretical pI: | 4.704 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 33.285 | ||
aromaticity | 0.111 | ||
GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.235 | ||
sheet | 0.216 |