Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318882.1 | 3prime_partial | 139 | 418-2(-) |
Amino Acid sequence : | |||
MASLISSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVLKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKE YKPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 16,008.209 | ||
Theoretical pI: | 4.935 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 45.488 | ||
aromaticity | 0.101 | ||
GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.209 | ||
sheet | 0.266 |