Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318889.1	5prime_partial	160	524-42(-)
Amino Acid sequence :
GLEMGYFAKEHSQTQLMVTHHYPQCPDPNSTIGIAEHCDGALINLLQQELPGLHVRAKDGKWFGVEPIPGALVVINGLILKVVSNGKLLAGVHRVVTNSTSDRTSVGSLISPVECIIEPA KILINENNPSLFKSFSYTEYLGYYFSDTTEIEAALKPYKL*
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,539.911
Theoretical pI:		5.834
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16055
Instability index:		30.336
aromaticity		0.081
GRAVY		-0.013
Secondary Structure Fraction
Helix		0.344
turn		0.269
sheet		0.250