Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318892.1 | 3prime_partial | 145 | 46-480(+) |
Amino Acid sequence : | |||
MPISRIAIGTPVEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIAAAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL LKFTTGGMEIGAFGLSDGVGVSNAL | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 10,620.089 | ||
Theoretical pI: | 4.815 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 56.773 | ||
aromaticity | 0.029 | ||
GRAVY | 0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.343 | ||
sheet | 0.324 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318892.1 | complete | 105 | 338-21(-) |
Amino Acid sequence : | |||
MLPPINAPNVTAGFTCPPDILAPTETATNNPKACATAAAMSPAGVLAPPPVNLLNATPEPEPANTKIKVEMNSANAAFKASGWVASTGVPIAIRLIGISSENQEC* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,620.089 | ||
Theoretical pI: | 4.815 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 56.773 | ||
aromaticity | 0.029 | ||
GRAVY | 0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.343 | ||
sheet | 0.324 |